PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g24850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family bZIP
Protein Properties Length: 227aa    MW: 26417.7 Da    PI: 9.6489
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g24850genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.6e-11121173557
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 ++ rr+ +NRe+ArrsR RK++ +e+L++ v  L+  N++L ++l  ++ +++
  CA02g24850 121 RKRRRMVSNRESARRSRMRKQKHLENLRNQVNRLKIGNRELMNRLRLITHQYQ 173
                 5779999*************************************999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-12117181IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461119182IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.75E-11121172No hitNo description
PfamPF001701.4E-8121173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-8121173No hitNo description
CDDcd147022.25E-17122173No hitNo description
PROSITE patternPS000360124139IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MLSTLSATTL SSDGLFSNSF AAFDGGFTPW ECIEPAFLFP RDVEEXXXXX XXEPVLSPKQ  60
SPPTEPVILN SDSGSDDSKP NSIHSSSGSD EPNRNNNNNS NRCLDERKRQ RTTSNRDIDE  120
RKRRRMVSNR ESARRSRMRK QKHLENLRNQ VNRLKIGNRE LMNRLRLITH QYQIFQCDNE  180
RLKTESAILG QRLEDIREIL RARQLQQQFN SYFAWPCSNY MEQRPH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106124RKRQRTTSNRDIDERKRRR
2120124RKRRR
3120141RKRRRMVSNRESARRSRMRKQK
4133140RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560923.11e-150PREDICTED: light-inducible protein CPRF2-like
TrEMBLM1BXK21e-103M1BXK2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552141e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.28e-30basic leucine-zipper 6